Rabbit MMP 9 Recombinant Protein (RPPB1969)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB1969
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Rabbit
- Target:
- MMP 9
- Synonyms:
- Matrix metalloproteinase-9
- Synonyms:
- MMP-9
- Synonyms:
- 92 kDa type IV collagenase
- Synonyms:
- 92 kDa gelatinase
- Source:
- Baculovirus system, insect cells
- Uniprot:
- P41246
Description
Product Name: | Rabbit MMP 9 Recombinant Protein |
Product Code: | RPPB1969 |
Size: | 10µg |
Species: | Rabbit |
Target: | MMP 9 |
Synonyms: | Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B. |
Source: | Baculovirus system, insect cells |
Physical Appearance: | Sterile Filtered clear solution. |
Formulation: | The MMP-9 solution (0.3mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5. |
Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Purity: | Greater than 85.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSSCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPEDENLYFQGLEEQKLISEEDLNSAVDHHHHHH |
Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. MMP9 cleaves type IV and type V collagens into large C-terminal three qu
MMP-9 Rabbit Recombinant is a full length secreted protein (688 amino acids - a.a. 20-707). The MMP-9 is expressed in insect cells and fused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa. Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.
UniProt Protein Function: | Function: Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments |
UniProt Protein Details: | Catalytic activity: Cleavage of gelatin types I and V and collagen types IV and V. Cofactor: Binds 2 zinc ions per subunit |
UniProt Code: | P41246 |
NCBI GenInfo Identifier: | 126723483 |
NCBI Gene ID: | 100008993 |
NCBI Accession: | NP_001075672.1 |
UniProt Related Accession: | P41246 |
Molecular Weight: | 78,308 Da |
NCBI Full Name: | matrix metalloproteinase-9 |
NCBI Official Symbol: | MMP9 |
NCBI Protein Information: | matrix metalloproteinase-9; GELB; MMP-9; gelatinase B; 92 kDa gelatinase; 92 kDa type IV collagenase; matrix metalloproteinase 9 |
UniProt Protein Name: | Matrix metalloproteinase-9 |
UniProt Synonym Protein Names: | 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB |
Protein Family: | Matrix metalloproteinase |
UniProt Gene Name: | MMP9 |
UniProt Entry Name: | MMP9_RABIT |