Mouse IL 19 Recombinant Protein (RPPB0629)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB0629
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Mouse
- Target:
- IL 19
- Synonyms:
- Interleukin-19
- Synonyms:
- IL-19
- Synonyms:
- Il19
- Source:
- Escherichia Coli
- Uniprot:
- Q8CJ70
Description
Product Name: | Mouse IL 19 Recombinant Protein |
Product Code: | RPPB0629 |
Size: | 10µg |
Species: | Mouse |
Target: | IL 19 |
Synonyms: | Interleukin-19, IL-19, Il19. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5. |
Solubility: | It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 95.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA |
IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis. |
UniProt Code: | Q8CJ70 |
NCBI GenInfo Identifier: | 57977321 |
NCBI Gene ID: | 329244 |
NCBI Accession: | NP_001009940.1 |
UniProt Related Accession: | Q8CJ70 |
Molecular Weight: | 20,288 Da |
NCBI Full Name: | interleukin-19 isoform 1 |
NCBI Synonym Full Names: | interleukin 19 |
NCBI Official Symbol: | Il19 |
NCBI Protein Information: | interleukin-19 |
UniProt Protein Name: | Interleukin-19 |
Protein Family: | Interleukin |
UniProt Gene Name: | Il19 |