| Sequence: | MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Accession: | P03969 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Fibroblast growth factor 2(FGF2) is a secreted protein and belongs to the heparin-binding growth factors family. FGF2 is produced by epithelial; tumor and other cell types. It involved in developmental processes and regulates differentiation; proliferation; and migration; FGF2 is a critical factor for growing embryonic stem cells in culture without inducing differentiation. FGF2 has a high affinity for heparan sulfate and binding is a step in the FGF basic activation of FGFR tyrosine kinase. |