Description
| Product Name: | Human TFF1 Recombinant Protein |
| Product Code: | RPPB0960 |
| Size: | 20µg |
| Species: | Human |
| Target: | TFF1 |
| Synonyms: | TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Human TFF1 protein was lyophilized from a 0.2�m filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl. |
| Solubility: | It is recommended to reconstitute the lyophilized TFF1 in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
| Biological Activity: | The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10�g/ml, corresponding to a specific activity of >100 IU/mg. |
The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease.
TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | TFF1: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine. |
| UniProt Protein Details: | Protein type:Secreted, signal peptide; Secreted Chromosomal Location of Human Ortholog: 21q22.3 Molecular Function:protein binding Biological Process: carbohydrate metabolic process |
| NCBI Summary: | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P04155 |
| NCBI GenInfo Identifier: | 131127 |
| NCBI Gene ID: | 7031 |
| NCBI Accession: | P04155.1 |
| UniProt Related Accession: | P04155 |
| Molecular Weight: | 9,150 Da |
| NCBI Full Name: | Trefoil factor 1 |
| NCBI Synonym Full Names: | trefoil factor 1 |
| NCBI Official Symbol: | TFF1�� |
| NCBI Official Synonym Symbols: | pS2; BCEI; HPS2; HP1.A; pNR-2; D21S21�� |
| NCBI Protein Information: | trefoil factor 1 |
| UniProt Protein Name: | Trefoil factor 1 |
| UniProt Synonym Protein Names: | Breast cancer estrogen-inducible protein; PNR-2; Polypeptide P1.A; hP1.A; Protein pS2 |
| Protein Family: | Trefoil factor |
| UniProt Gene Name: | TFF1�� |
| UniProt Entry Name: | TFF1_HUMAN |