Description
| Product Name: | Human MOG Recombinant Protein |
| Product Code: | RPPB3989 |
| Size: | 50µg |
| Species: | Human |
| Target: | MOG |
| Synonyms: | Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2�m filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 |
| Solubility: | It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |
Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
| UniProt Protein Function: | MOG: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7). Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Belongs to the immunoglobulin superfamily. BTN/MOG family. 10 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Membrane protein, integral; Membrane protein, multi-pass Chromosomal Location of Human Ortholog: 6p22.1 Cellular Component: integral to membrane; plasma membrane Biological Process: central nervous system development; positive regulation of MyD88-dependent toll-like receptor signaling pathway; cell adhesion Disease: Narcolepsy 7 |
| NCBI Summary: | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| UniProt Code: | Q16653 |
| NCBI GenInfo Identifier: | 317373391 |
| NCBI Gene ID: | 4340 |
| NCBI Accession: | Q16653.2 |
| UniProt Secondary Accession: | Q16653,O00713, O00714, O00715, Q13054, Q13055, A6NDR4 A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, |
| UniProt Related Accession: | Q16653 |
| Molecular Weight: | 247 |
| NCBI Full Name: | Myelin-oligodendrocyte glycoprotein |
| NCBI Synonym Full Names: | myelin oligodendrocyte glycoprotein |
| NCBI Official Symbol: | MOG�� |
| NCBI Official Synonym Symbols: | BTN6; BTNL11; MOGIG2; NRCLP7�� |
| NCBI Protein Information: | myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5 |
| UniProt Protein Name: | Myelin-oligodendrocyte glycoprotein |
| Protein Family: | Molybdopterin adenylyltransferase |
| UniProt Gene Name: | MOG�� |
| UniProt Entry Name: | MOG_HUMAN |