E.Coli TXN1 Recombinant Protein (RPPB5927)
- SKU:
- RPPB5927
- Product type:
- Recombinant Protein
- Size:
- 100ug
- Species:
- E.Coli
- Target:
- TXN1
- Synonyms:
- Thioredoxin-1
- Trx-1
- trxA
- fipA
- Source:
- Escherichia Coli
- Uniprot:
- P0AA25
Description
Product Name: | E.Coli TXN1 Recombinant Protein |
Product Code: | RPPB5927 |
Size: | 100µg |
Species: | E.Coli |
Target: | TXN1 |
Synonyms: | Thioredoxin-1, Trx-1, trxA, fipA, tsnC, b3781, JW5856. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Lyophilized Powder. |
Formulation: | Each mg of protein contains 20mM phosphate buffer pH 7.4. |
Solubility: | It is recommended to reconstitute the lyophilized TRX in sterile 18M?-cm H2O. |
Stability: | TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please prevent freeze thaw cycles. |
Purity: | Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA |
Biological Activity: | TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13µM bovine insulin containing 0.33mM DTT (pH 6.5).The specific activity was found to be 3IU/mg. |
Thioredoxins are small disulphide-containing redox proteins (within the conserved Cys-Gly-Pro-Cys active site) that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. Thioredoxins are involved in the first unique step in DNA synthesis. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase.Its Molecular Weight is 11.9kDa. and the pI is 4.67.
Recombinant Thioredoxin was purified from E. coli harboring its gene.
UniProt Protein Function: | Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. |
UniProt Protein Details: | |
NCBI Summary: | |
UniProt Code: | P0AA25 |
NCBI GenInfo Identifier: | 67005950 |
NCBI Gene ID: | 23335415 |
NCBI Accession: | NP_418228.2 |
UniProt Secondary Accession: | P0AA25,P00274, P76750, Q2M889, Q47674, Q8XAT2 |
UniProt Related Accession: | P0AA25 |
Molecular Weight: | |
NCBI Full Name: | thioredoxin 1 |
NCBI Synonym Full Names: | |
NCBI Official Symbol: | trxA |
NCBI Official Synonym Symbols: | |
NCBI Protein Information: | thioredoxin |
UniProt Protein Name: | Thioredoxin-1 |
UniProt Synonym Protein Names: | |
Protein Family: | Thioredoxin |
UniProt Gene Name: | trxA |
UniProt Entry Name: | THIO_ECOLI |